PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr036672.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 323aa    MW: 36193.1 Da    PI: 6.6197
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr036672.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.46.6e-131156146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +g+W +eEde l++ vk+ G+++W++I ++  + Rt+k+c++rw +
      Pbr036672.1 11 KGPWKAEEDEVLLKHVKKCGPRDWSSIRSKGLLQRTGKSCRLRWVN 56
                     79*************************8887799**********87 PP

2Myb_DNA-binding41.62.8e-1367106344
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                      +++ eE+   +++ +q+G++ W++Ia +++ gRt++++k++w
      Pbr036672.1  67 KFSVEEERVVIELQAQFGNK-WARIATYLP-GRTDNDVKNFW 106
                      799*****************.*********.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-20659IPR009057Homeodomain-like
PROSITE profilePS5129420.57662IPR017930Myb domain
SuperFamilySSF466895.86E-288106IPR009057Homeodomain-like
SMARTSM007172.6E-101060IPR001005SANT/Myb domain
CDDcd001677.16E-111358No hitNo description
PfamPF139218.3E-121464No hitNo description
Gene3DG3DSA:1.10.10.601.2E-1760112IPR009057Homeodomain-like
PROSITE profilePS5129418.31563114IPR017930Myb domain
SMARTSM007174.4E-1264112IPR001005SANT/Myb domain
PfamPF002491.3E-1167106IPR001005SANT/Myb domain
CDDcd001673.34E-1067106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MEGKKEEGIR KGPWKAEEDE VLLKHVKKCG PRDWSSIRSK GLLQRTGKSC RLRWVNKLRP  60
NLKNGCKFSV EEERVVIELQ AQFGNKWARI ATYLPGRTDN DVKNFWSSRQ KRLARILQTS  120
AAPPAPPSSK SHKTKREVSV FHELPTTMEA TKFNCSSEGE PSSQAQQCLS PPPYFRNSEI  180
IKMVALPDIV KPKSLCFETN PVQHELPITD KDPWTDSHTA IPFLQNPQPQ TDQIFSSETQ  240
EFLARFDPYF DVLGPLDALG LGNGGEPLVM EPPLFEPVGS CLSCEGGRID HTMTPDCVFD  300
DFPTDMFDQI DPLPNTSGSG QH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-26911225126MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009343900.10.0PREDICTED: transcription factor MYB24-like
TrEMBLM5VT831e-156M5VT83_PRUPE; Uncharacterized protein
STRINGVIT_15s0021g02040.t011e-114(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36933164
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.17e-90MYB family protein